CENPN Rabbit Polyclonal Antibody

CAT#: TA344859

Rabbit Polyclonal Anti-CENPN Antibody - middle region


USD 475.00

5 Days*

Size
    • 100 ul

Frequently bought together (2)
Transient overexpression lysate of centromere protein N (CENPN), transcript variant 1
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "CENPN"

Specifications

Product Data
Applications IF, WB
Recommended Dilution WB, IF
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CENPN antibody: synthetic peptide directed towards the middle region of human CENPN. Synthetic peptide located within the following region: SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 41 kDa
Gene Name centromere protein N
Background The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). CENPN is an additional factor required for centromere assembly (Foltz et al., 2006 [PubMed 16622419]).
Synonyms BM039; C16orf60; CENP-N; ICEN32
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 86%; Pig: 86%; Bovine: 86%; Guinea pig: 86%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.