CENPN Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of centromere protein N (CENPN), transcript variant 1
USD 396.00
Other products for "CENPN"
Specifications
Product Data | |
Applications | IF, WB |
Recommended Dilution | WB, IF |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CENPN antibody: synthetic peptide directed towards the middle region of human CENPN. Synthetic peptide located within the following region: SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 41 kDa |
Gene Name | centromere protein N |
Database Link | |
Background | The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). CENPN is an additional factor required for centromere assembly (Foltz et al., 2006 [PubMed 16622419]). |
Synonyms | BM039; C16orf60; CENP-N; ICEN32 |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 86%; Pig: 86%; Bovine: 86%; Guinea pig: 86%; Rat: 79%; Mouse: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.