CENPN Rabbit Polyclonal Antibody

CAT#: TA344859

Rabbit Polyclonal Anti-CENPN Antibody - middle region

Product Images

WB Suggested Anti-CENPN Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysateCENPN is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Sample Type : DNA/ACA;

• 

  Sample Type : HeLa; Primary Antibody Dilution: 4 ug/ml; Secondary Antibody : Anti-rabbit Alexa 546; Secondary Antibody Dilution: 2 ug/ml; Gene Name : CENPN

• 

  Sample Type : Huh-7; Primary Antibody Dilution: 4 ug/ml; Secondary Antibody : Anti-rabbit Alexa 546; Secondary Antibody Dilution: 2 ug/ml; Gene Name : CENPN

• 

  Sample Type : MCF7; Primary Antibody Dilution: 4 ug/ml; Secondary Antibody : Anti-rabbit Alexa 546; Secondary Antibody Dilution: 2 ug/ml; Gene Name : CENPN

Show all 5 images

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB, IF
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CENPN antibody: synthetic peptide directed towards the middle region of human CENPN. Synthetic peptide located within the following region: SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: centromere protein N
• Database Link:
  NP_001094095
  Entrez Gene 55839 Human
  UniProt ID Q96H22
• Background: The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). CENPN is an additional factor required for centromere assembly (Foltz et al., 2006 [PubMed 16622419]).
• Synonyms: BM039; C16orf60; CENP-N; ICEN32
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 86%; Pig: 86%; Bovine: 86%; Guinea pig: 86%; Rat: 79%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome