PI 4 Kinase type 2 beta (PI4K2B) Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human phosphatidylinositol 4-kinase type 2 beta (PI4K2B)
USD 823.00
Transient overexpression lysate of phosphatidylinositol 4-kinase type 2 beta (PI4K2B)
USD 396.00
Other products for "PI4K2B"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PI4K2B antibody: synthetic peptide directed towards the middle region of human PI4K2B. Synthetic peptide located within the following region: IIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLIPNQGYLSEAGA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 55 kDa |
Gene Name | phosphatidylinositol 4-kinase type 2 beta |
Database Link | |
Background | Phosphatidylinositol 4-kinases (PI4Ks) phosphorylate phosphatidylinositol to generate phosphatidylinositol 4-phosphate (PIP), an immediate precursor of several important signaling and scaffolding molecules. PIP itself may also have direct functional and s |
Synonyms | PI4KIIB; PIK42B |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 93%; Bovine: 93%; Zebrafish: 93%; Dog: 86%; Yeast: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.