TDP1 Rabbit Polyclonal Antibody

CAT#: TA344881

Rabbit Polyclonal Anti-TDP1 Antibody - C-terminal region

Product Images

Host: Rabbit; Target Name: Tdp1; Sample Tissue: Mouse Lung lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Tdp1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Tdp1. Synthetic peptide located within the following region: GRPPGKSAVPLHLIYPSVENVRTSLEGYPAGGSLPYSIQTAEKQRWLHSY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 66 kDa
• Gene Name: tyrosyl-DNA phosphodiesterase 1
• Database Link:
  NP_060789
  Entrez Gene 104884 Mouse
  UniProt ID Q9NUW8
• Background: Tdp1 is a DNA repair enzyme that can remove a variety of covalent adducts from DNA through hydrolysis of a 3'-phosphodiester bond, giving rise to DNA with a free 3' phosphate. It catalyzes the hydrolysis of dead-end complexes between DNA and the topoisomerase I active site tyrosine residue and Hydrolyzes 3'-phosphoglycolates on protruding 3' ends on DNA double-strand breaks due to DNA damage by radiation and free radicals. Tdp1 acts on blunt-ended double-strand DNA breaks and on single-stranded DNA. It Has low h3'exonuclease activity and can remove a single nucleoside from the 3'end of DNA and RNA molecules with 3'hydroxyl groups and has no exonuclease activity towards DNA or RNA with a 3'phosphate.
• Synonyms: FLJ11090; MGC104252
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome