OGDHL Rabbit Polyclonal Antibody
USD 867.00
USD 325.00
USD 159.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-OGDHL antibody: synthetic peptide directed towards the N terminal of human OGDHL. Synthetic peptide located within the following region: VFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHKSWDSFFR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 114 kDa |
Gene Name | oxoglutarate dehydrogenase-like |
Database Link | |
Background | The function of OGDHL remains unknown. |
Synonyms | FLJ10851 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Horse: 92%; Rat: 85%; Bovine: 85% |
Reference Data | |
Protein Pathways | Citrate cycle (TCA cycle), Lysine degradation, Metabolic pathways, Tryptophan metabolism |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review