ZCCHC8 Rabbit Polyclonal Antibody

CAT#: TA344986

Rabbit Polyclonal Anti-ZCCHC8 Antibody - C-terminal region

Product Images

Host: Rabbit; Target Name: Zcchc8; Sample Tissue: Rat Thymus lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Zcchc8 antibody is: synthetic peptide directed towards the C-terminal region of Rat Zcchc8. Synthetic peptide located within the following region: FQPPLPPGTPPPLPQGTPPPLFTPPLPKGTPPLTPSDSPQPRPTASGVDE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: zinc finger CCHC-type containing 8
• Database Link:
  NP_060082
  Entrez Gene 288661 Rat
  UniProt ID Q6NZY4
• Background: The function of this protein remains unknown.
• Synonyms: DKFZp434E2220
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%