TBC1D7 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of TBC1 domain family, member 7 (TBC1D7), transcript variant 4
USD 396.00
Other products for "TBC1D7"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Tbc1d7 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Tbc1d7. Synthetic peptide located within the following region: ISRCFVKQLNNKYRDALPQLPKAFEQYLNLEDSRLLSHLKTCSAVSKLPY |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 32 kDa |
Gene Name | TBC1 domain family member 7 |
Database Link | |
Background | Tbc1d7 is a component of the TSC-TBC complex, that contains TBC1D7 in addition to the TSC1-TSC2 complex and consists of the functional complex possessing GTPase-activating protein (GAP) activity toward RHEB in response to alterations in specific cellular growth conditions. The small GTPase RHEB is a direct activator of the protein kinase activity of mTORC1 and the TSC-TBC complex acts as a negative regulator of mTORC1 signaling cascade by acting as a GAP for RHEB. Participates in the proper sensing of growth factors and glucose, but not amino acids, by mTORC1. It is unclear whether TBC1D7 acts as a GTPase-activating protein and additional studies are required to answer this question. |
Synonyms | MGCPH; PIG51; TBC7 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Guinea pig: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.