AK3 Rabbit Polyclonal Antibody

CAT#: TA345043

Rabbit Polyclonal Anti-AK3 Antibody - N-terminal region

Product Images

WB Suggested Anti-AK3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AK3 antibody: synthetic peptide directed towards the N terminal of human AK3. Synthetic peptide located within the following region: MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: adenylate kinase 3
• Database Link:
  NP_057366
  Entrez Gene 50808 Human
  UniProt ID Q9UIJ7
• Background: The function of this protein remains unknown.
• Synonyms: AK3L1; AK6; AKL3L; AKL3L1; FIX
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Pyrimidine metabolism