Acetylcholinesterase (ACHE) Rabbit Polyclonal Antibody

CAT#: TA345106

Rabbit Polyclonal Anti-ACHE Antibody - middle region

Product Images

WB Suggested Anti-ACHE Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACHE antibody: synthetic peptide directed towards the middle region of human ACHE. Synthetic peptide located within the following region: VGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: acetylcholinesterase (Cartwright blood group)
• Database Link:
  NP_000656
  Entrez Gene 43 Human
  UniProt ID P22303
• Background: This gene encodes a member of the neuroD family of neurogenic basic helix-loop-helix (bHLH) proteins. Expression of this gene can induce transcription from neuron-specific promoters, such as the GAP-43 promoter, which contain a specific DNA sequence known as an E-box. The product of the human gene can induce neurogenic differentiation in non-neuronal cells in Xenopus embryos, and is thought to play a role in the determination and maintenance of neuronal cell fates. [provided by RefSeq, Jul 2008]
• Synonyms: ACEE; ARACHE; N-ACHE; YT
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Zebrafish: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Glycerophospholipid metabolism