Tbp7 (PSMC4) Rabbit Polyclonal Antibody

CAT#: TA345132

Rabbit Polyclonal Anti-PSMC4 Antibody - N-terminal region

Product Images

WB Suggested Anti-PSMC4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Muscle

• 

  Lanes: 1: 10ug proteasome fraction from C57B1/6J mouse brain, 2: 10ug proteasome fraction from BLAB/C mouse brain; Primary Antibody Dilution: 1:500; Secondary Antibody: Anti-rabbit HRP; Secondary Antibody Dilution: 1:5000; Gene Name: PSMC4; Submitted by:

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PSMC4 antibody: synthetic peptide directed towards the N terminal of human PSMC4. Synthetic peptide located within the following region: MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: proteasome 26S subunit, ATPase 4
• Database Link:
  NP_006494
  Entrez Gene 23996 MouseEntrez Gene 5704 Human
  UniProt ID P43686
• Background: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the triple-A family of ATPases that is a component of the 19S regulatory subunit and plays a role in 26S proteasome assembly. The encoded protein interacts with gankyrin, a liver oncoprotein, and may also play a role in Parkinson's disease through interactions with synphilin-1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]
• Synonyms: MIP224; RPT3; S6; TBP-7; TBP7
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Yeast: 90%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Proteasome