Tbp7 (PSMC4) Rabbit Polyclonal Antibody

CAT#: TA345133

Rabbit Polyclonal Anti-PSMC4 Antibody - N-terminal region


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1
    • 20 ug

USD 823.00


Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "PSMC4"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PSMC4 antibody: synthetic peptide directed towards the N terminal of human PSMC4. Synthetic peptide located within the following region: MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 47 kDa
Gene Name proteasome 26S subunit, ATPase 4
Background The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the triple-A family of ATPases that is a component of the 19S regulatory subunit and plays a role in 26S proteasome assembly. The encoded protein interacts with gankyrin, a liver oncoprotein, and may also play a role in Parkinson's disease through interactions with synphilin-1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]
Synonyms MIP224; RPT3; S6; TBP-7; TBP7
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%
Reference Data
Protein Families Druggable Genome
Protein Pathways Proteasome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.