PKC eta (PRKCH) Rabbit Polyclonal Antibody

CAT#: TA345138

Rabbit Polyclonal Anti-PRKCH Antibody - C-terminal region

Product Images

WB Suggested Anti-Prkch Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Prkch antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TPDYIAPEILQEMLYGPAVDWWAMGVLLYEMLCGHAPFEAENEDDLFEAI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 75 kDa
• Gene Name: protein kinase C eta
• Database Link:
  NP_006246
  Entrez Gene 18755 Mouse
  UniProt ID P24723
• Background: This is calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme.
• Synonyms: nPKC-eta; PKC-L; PKCL; PRKCL
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Tight junction, Vascular smooth muscle contraction