PLCD1 Rabbit Polyclonal Antibody

CAT#: TA345145

Rabbit Polyclonal Anti-PLCD1 Antibody - N-terminal region

Product Images

WB Suggested Anti-PLCD1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PLCD1 antibody: synthetic peptide directed towards the N terminal of human PLCD1. Synthetic peptide located within the following region: DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 86 kDa
• Gene Name: phospholipase C delta 1
• Database Link:
  NP_006216
  Entrez Gene 5333 Human
  UniProt ID P51178
• Background: This gene encodes a member of the phospholipase C family. Phospholipase C isozymes play critical roles in intracellular signal transduction by catalyzing the hydrolysis of phosphatidylinositol 4,5-bisphosphate (PIP2) into the second messengers diacylglycerol (DAG) and inositol triphosphate (IP3). The encoded protein functions as a tumor suppressor in several types of cancer, and mutations in this gene are a cause of hereditary leukonychia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]
• Synonyms: NDNC3; PLC-III
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Calcium signaling pathway, Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system