PPAR gamma (PPARG) Rabbit Polyclonal Antibody

CAT#: TA345179

Rabbit Polyclonal Anti-PPARG Antibody

Product Images

WB Suggested Anti-PPARG Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PPARG antibody: synthetic peptide directed towards the N terminal of human PPARG. Synthetic peptide located within the following region: MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: peroxisome proliferator activated receptor gamma
• Database Link:
  NP_056953
  Entrez Gene 5468 Human
  UniProt ID P37231
• Background: PPARG is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer.The protein encoded by this gene is a member of the peroxisome pr
• Synonyms: CIMT1; GLM1; NR1C3; PPARG1; PPARG2; PPARgamma
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Dog: 79%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
• Protein Pathways: Huntington's disease, Pathways in cancer, PPAR signaling pathway, Thyroid cancer