TIF1 gamma (TRIM33) Rabbit Polyclonal Antibody

CAT#: TA345182

Rabbit Polyclonal Anti-TRIM33 Antibody

Product Images

WB Suggested Anti-TRIM33 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Hela cell lysate; TRIM33 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells

• 

  Sample Type: MCF7; Primary Antibody Dilution: 4 ug/ml; Secondary Antibody: Anti-rabbit Alexa 546; Secondary Antibody Dilution: 2 ug/ml; Gene Name: TRIM33

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRIM33 antibody: synthetic peptide directed towards the middle region of human TRIM33. Synthetic peptide located within the following region: EIYSDRTFAPLPEFEQEEDDGEVTEDSDEDFIQPRRKRLKSDERPVHIK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 122 kDa
• Gene Name: tripartite motif containing 33
• Database Link:
  NP_056990
  Entrez Gene 51592 Human
  UniProt ID Q9UPN9
• Background: TRIM33 is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined.
• Synonyms: ECTO; PTC7; RFG7; TF1G; TIF1G; TIF1GAMMA; TIFGAMMA
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase, Transcription Factors