WBP5 (TCEAL9) Rabbit Polyclonal Antibody

CAT#: TA345199

Rabbit Polyclonal Anti-WBP5 Antibody

Product Images

WB Suggested Anti-WBP5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-WBP5 antibody: synthetic peptide directed towards the middle region of human WBP5. Synthetic peptide located within the following region: TFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 13 kDa
• Gene Name: transcription elongation factor A like 9
• Database Link:
  NP_057387
  Entrez Gene 51186 Human
  UniProt ID Q9UHQ7
• Background: The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Alternative splicing results in multiple transcript variants encoding a single isoform.
• Synonyms: WBP5; WEX6
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Rat: 93%; Pig: 86%; Horse: 86%; Bovine: 79%