KDM4D Rabbit Polyclonal Antibody

CAT#: TA345235

Rabbit Polyclonal Anti-JMJD2D Antibody

Product Images

WB Suggested Anti-JMJD2D Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

• 

  Human kidney

• 

  Human Intestine

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-JMJD2D antibody: synthetic peptide directed towards the C terminal of human JMJD2D. Synthetic peptide located within the following region: RAQELTLQTPAKRPLLAGTTCTASGPEPEPLPEDGALMDKPVPLSPGLQH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: lysine demethylase 4D
• Database Link:
  NP_060509
  Entrez Gene 55693 Human
  UniProt ID Q6B0I6
• Background: JMJD2D belongs to JMJD2 family that is consist of four cancer-associated genes
• Synonyms: JMJD2D
• Note: Immunogen Sequence Homology: Human: 100%