ZNF313 (RNF114) Rabbit Polyclonal Antibody

CAT#: TA345260

Rabbit Polyclonal Anti-ZNF313 Antibody

Product Images

WB Suggested Anti-ZNF313 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: COLO205 cell lysate; RNF114 is strongly supported by BioGPS gene expression data to be expressed in Human COLO205 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF313 antibody: synthetic peptide directed towards the C terminal of human ZNF313. Synthetic peptide located within the following region: VVCPICASMPWGDPNYRSANFREHIQRRHRFSYDTFVDYDVDEEDMMNQV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: ring finger protein 114
• Database Link:
  NP_061153
  Entrez Gene 55905 Human
  UniProt ID Q9Y508
• Background: ZNF313 may play a role in spermatogenesis.
• Synonyms: PSORS12; ZNF313
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Guinea pig: 93%; Zebrafish: 85%; Yeast: 75%