TEF1 (TEAD1) Rabbit Polyclonal Antibody

CAT#: TA345347

Rabbit Polyclonal Anti-TEAD1 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "TEAD1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TEAD1 antibody: synthetic peptide directed towards the C terminal of human TEAD1. Synthetic peptide located within the following region: YMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHIYRLVK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 46 kDa
Gene Name TEA domain transcription factor 1
Background TEAD1 is a transcriptional enhancer. It interacts with a muscle-specific cofactor to promote skeletal muscle gene expression. The mutation in the TEAD1 gene is the cause of Sveinsson's chorioretinal atrophy
Synonyms AA; NTEF-1; REF1; TCF-13; TCF13; TEAD-1; TEF-1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.