HSPBAP1 Rabbit Polyclonal Antibody

CAT#: TA345389

Rabbit Polyclonal Anti-HSPBAP1 Antibody

Product Images

WB Suggested Anti-HSPBAP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HSPBAP1 antibody: synthetic peptide directed towards the N terminal of human HSPBAP1. Synthetic peptide located within the following region: AAGSEATTPVIVAAGAGGEEGEHVKPFKPEKAKEIIMSLQQPAIFCNMVF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: HSPB1 associated protein 1
• Database Link:
  NP_078886
  Entrez Gene 79663 Human
  UniProt ID Q96EW2
• Background: HSPBAP1 may play a role in cellular stress response. A chromosomal aberration involving HSPBAP1 is found in familial renal cell carcinoma 1 (RCC1).
• Synonyms: PASS1
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 92%; Rat: 86%; Mouse: 86%; Bovine: 86%; Dog: 85%; Pig: 83%; Guinea pig: 83%; Rabbit: 79%