HSPBAP1 Rabbit Polyclonal Antibody

CAT#: TA345390

Rabbit Polyclonal Anti-HSPBAP1 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human HSPB (heat shock 27kDa) associated protein 1 (HSPBAP1)
    • 20 ug

USD 823.00


Transient overexpression lysate of HSPB (heat shock 27kDa) associated protein 1 (HSPBAP1)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "HSPBAP1"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-HSPBAP1 antibody: synthetic peptide directed towards the C terminal of human HSPBAP1. Synthetic peptide located within the following region: SDGKDFVDKDGEHFGKLHCAKRQQIMSNSENAIEEQIASNTTTTPQTFIS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 55 kDa
Gene Name HSPB1 associated protein 1
Background HSPBAP1 may play a role in cellular stress response.
Synonyms PASS1
Note Immunogen Sequence Homology: Human: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.