GERP (TRIM8) Rabbit Polyclonal Antibody

CAT#: TA345418

Rabbit Polyclonal Anti-TRIM8 Antibody

Product Images

WB Suggested Anti-TRIM8 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Hela cell lysate

• 

  Immunohistochemistry with Human Testis lysate tissue at an antibody concentration of 5.0 ug/ml using anti-TRIM8 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRIM8 antibody: synthetic peptide directed towards the N terminal of human TRIM8. Synthetic peptide located within the following region: RGCIGEAWAKDSGLVRCPECNQAYNQKPGLEKNLKLTNIVEKFNALHVEK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: tripartite motif containing 8
• Database Link:
  NP_112174
  Entrez Gene 81603 Human
  UniProt ID Q9BZR9
• Background: TRIM8 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to nuclear bodies. Its structure is similar to some tumor suppressor proteins and its gene maps to a locus thought to contain tumor suppressor genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to nuclear bodies. Its structure is similar to some tumor suppressor proteins and its gene maps to a locus thought to contain tumor suppressor genes.
• Synonyms: GERP; RNF27
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Zebrafish: 79%