SOX7 Rabbit Polyclonal Antibody

CAT#: TA345428

Rabbit Polyclonal Anti-SOX7 Antibody

Product Images

WB Suggested Anti-SOX7 Antibody Titration: 1 ug/ml; Positive Control: Fetal Stomach cell lysate

• 

  Immunohistochemistry with Transfected 293T cell lysate tissue at an antibody concentration of 1 g/ml using anti-SOX7 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SOX7 antibody: synthetic peptide directed towards the middle region of human SOX7. Synthetic peptide located within the following region: LLGDMDRNEFDQYLNTPGHPDSATGAMALSGHVPVSQVTPTGPTETSLIS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: SRY-box 7
• Database Link:
  NP_113627
  Entrez Gene 83595 Human
  UniProt ID Q9BT81
• Background: SOX7 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. SOX7 may act as a transcriptional regulator after forming a protein complex with other proteins. It may play a role in tumorigenesis. A similar protein in mice is involved in the regulation of the wingless-type MMTV integration site family (Wnt) pathway. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may play a role in tumorigenesis. A similar protein in mice is involved in the regulation of the wingless-type MMTV integration site family (Wnt) pathway.
• Synonyms: MGC10895
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors