ZNF394 Rabbit Polyclonal Antibody

CAT#: TA345436

Rabbit Polyclonal Anti-ZNF394 Antibody

Product Images

WB Suggested Anti-ZNF394 Antibody Titration: 0.2-1 ug/ml; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF394 antibody: synthetic peptide directed towards the N terminal of human ZNF394. Synthetic peptide located within the following region: MNSSLTAQRRGSDAELGPWVMAARSKDAAPSQRDGLLPVKVEEDSPGSWE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: zinc finger protein 394
• Database Link:
  NP_115540
  Entrez Gene 84124 Human
  UniProt ID Q53GI3
• Background: ZNF394 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers, 1 KRAB domain and 1 SCAN box domain. ZNF394 may be involved in transcriptional regulation.
• Synonyms: ZKSCAN14; ZSCAN46
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors