ZNF394 Rabbit Polyclonal Antibody

CAT#: TA345436

Rabbit Polyclonal Anti-ZNF394 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human zinc finger protein 394 (ZNF394)
    • 20 ug

USD 823.00


Transient overexpression lysate of zinc finger protein 394 (ZNF394)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "ZNF394"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF394 antibody: synthetic peptide directed towards the N terminal of human ZNF394. Synthetic peptide located within the following region: MNSSLTAQRRGSDAELGPWVMAARSKDAAPSQRDGLLPVKVEEDSPGSWE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 64 kDa
Gene Name zinc finger protein 394
Background ZNF394 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers, 1 KRAB domain and 1 SCAN box domain. ZNF394 may be involved in transcriptional regulation.
Synonyms ZKSCAN14; ZSCAN46
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.