MINA53 (MINA) Rabbit Polyclonal Antibody

CAT#: TA345456

Rabbit Polyclonal Anti-MINA Antibody


USD 410.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "RIOX2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MINA antibody: synthetic peptide directed towards the C terminal of human MINA. Synthetic peptide located within the following region: HGLRFPLSHLDALKQIWNSPAISVKDLKLTTDEEKESLVLSLWTECLIQV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 53 kDa
Gene Name MYC induced nuclear antigen
Background MINA protein is directly involved in ribosome biogenesis, most likely during the assembly process of preribosomal particles. MINA is also involved in cell proliferation. MINA may have a role in esophageal squamous cell carcinoma, colon cancer and lung cancer
Synonyms MDIG; MINA53; NO52; ROX
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Mouse: 92%; Bovine: 92%; Guinea pig: 92%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.