TRIM5 alpha (TRIM5) Rabbit Polyclonal Antibody

CAT#: TA345468

Rabbit Polyclonal Anti-TRIM5 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Frequently bought together (2)
Transient overexpression lysate of tripartite motif-containing 5 (TRIM5), transcript variant alpha
    • 100 ug

USD 665.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "TRIM5"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TRIM5 antibody: synthetic peptide directed towards the N terminal of human TRIM5. Synthetic peptide located within the following region: CQACLTANHKKSMLDKGESSCPVCRISYQPENIRPNRHVANLVEKLREVK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 56 kDa
Gene Name tripartite motif containing 5
Background The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein forms homo-oligomers via the coilel-co
Synonyms RNF88; TRIM5alpha
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.