PML Protein (PML) Rabbit Polyclonal Antibody

CAT#: TA345476

Rabbit Polyclonal Anti-PML Antibody

Product Images

PML antibody - middle region validated by WB using Neuroblastoma at 1: 500.

• 

  Hum. Adult Placenta; Host: Rabbit; Target Name: SERPINA3; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-PML Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: ACHN cell lysate; There is BioGPS gene expression data showing that PML is expressed in ACHN

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PML antibody: synthetic peptide directed towards the middle region of human PML. Synthetic peptide located within the following region: TTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 97 kDa
• Gene Name: promyelocytic leukemia
• Database Link:
  NP_150241
  Entrez Gene 5371 Human
  UniProt ID P29590
• Background: PML is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. PML localizes to nuclear bodies where it functions as a transcription factor an
• Synonyms: MYL; PP8675; RNF71; TRIM19
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Acute myeloid leukemia, Pathways in cancer, Ubiquitin mediated proteolysis