CTIP2 (BCL11B) Rabbit Polyclonal Antibody

CAT#: TA345503

Rabbit Polyclonal Anti-BCL11B Antibody

Product Images

WB Suggested Anti-BCL11B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Jurkat cell lysate; BCL11B is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BCL11B antibody: synthetic peptide directed towards the C terminal of human BCL11B. Synthetic peptide located within the following region: RHMKTHGQIGKEVYRCDICQMPFSVYSTLEKHMKKWHGEHLLTNDVKIEQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 95 kDa
• Gene Name: B-cell CLL/lymphoma 11B
• Database Link:
  NP_612808
  Entrez Gene 64919 Human
  UniProt ID Q9C0K0
• Background: This gene encodes a C2H2-type zinc finger protein and is closely related to BCL11A, a gene whose translocation may be associated with B-cell malignancies. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants, which encode distinct isoforms, have been reported.
• Synonyms: ATL1; ATL1-alpha; ATL1-beta; ATL1-delta; ATL1-gamma; CTIP-2; CTIP2; hRIT1-alpha; RIT1; ZNF856B
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome