MLX Rabbit Polyclonal Antibody

CAT#: TA345582

Rabbit Polyclonal Anti-MLX Antibody

Product Images

WB Suggested Anti-MLX Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MLX antibody: synthetic peptide directed towards the N terminal of human MLX. Synthetic peptide located within the following region: MTEPGASPEDPWVKASPVGAHAGEGRAGRARARRGAGRRGASLLSPKSPT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: MLX, MAX dimerization protein
• Database Link:
  NP_733752
  Entrez Gene 6945 Human
  UniProt ID Q9UH92
• Background: MLX belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. MLX may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4.The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
• Synonyms: bHLHd13; MAD7; MXD7; TCFL4
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors