ZNF596 Rabbit Polyclonal Antibody

CAT#: TA345594

Rabbit Polyclonal Anti-ZNF596 Antibody

Product Images

WB Suggested Anti-ZNF596 Antibody Titration: 5.0 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF596 antibody: synthetic peptide directed towards the C terminal of human ZNF596. Synthetic peptide located within the following region: CGKAFNHSSVLRRHERTHTGEKPYECNICGKAFNRSYNFRLHRRVHTGEK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: zinc finger protein 596
• Database Link:
  NP_775810
  Entrez Gene 169270 Human
  UniProt ID Q8TC21
• Background: ZNF596 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
• Synonyms: FLJ36123
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 90%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors