Foxc2 Rabbit Polyclonal Antibody

CAT#: TA345653

Rabbit Polyclonal Anti-Foxc2 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00


Purified recombinant protein of Mouse forkhead box C2 (Foxc2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
    • 20 ug

USD 748.00

Other products for "Foxc2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Foxc2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GMGRSYAPYHHQPAAPKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 53 kDa
Gene Name forkhead box C2
Background Foxc2 is a transcriptional activator. Foxc2 might be involved in the formation of special mesenchymal tissues.
Synonyms FKHL14; LD; MFH-1; MFH1
Note Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.