GAPDHS Rabbit Polyclonal Antibody

CAT#: TA345676

Rabbit Polyclonal Anti-GAPDHS Antibody

Product Images

WB Suggested Anti-GAPDHS Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GAPDHS antibody: synthetic peptide directed towards the N terminal of human GAPDHS. Synthetic peptide located within the following region: PFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: glyceraldehyde-3-phosphate dehydrogenase, spermatogenic
• Database Link:
  NP_055179
  Entrez Gene 26330 Human
  UniProt ID O14556
• Background: GAPDHS is a protein belonging to the glyceraldehyde-3-phosphate dehydrogenase family of enzymes that play an important role in carbohydrate metabolism. Like its somatic cell counterpart, this sperm-specific enzyme functions in a nicotinamide adenine dinuc
• Synonyms: GAPD2; GAPDH-2; GAPDS; HEL-S-278; HSD-35
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Horse: 85%; Pig: 79%; Mouse: 79%; Guinea pig: 79%; Rat: 77%; Rabbit: 77%

Reference Data

• Protein Families: Druggable Genome