Germany
Japan
United Kingdom
China
PRMT7 Rabbit Polyclonal Antibody
Product Images
USD 396.00
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-PRMT7 antibody: synthetic peptide directed towards the N terminal of human PRMT7. Synthetic peptide located within the following region: MKIFCSRANPTTGSVEWLEEDEHYDYHQEIARSSYADMLHDKDRNVKYYQ |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 78 kDa |
| Gene Name | protein arginine methyltransferase 7 |
| Database Link | |
| Background | Arginine methylation is an apparently irreversible protein modification catalyzed by arginine methyltransferases, such as PMT7, using S-adenosylmethionine (AdoMet) as the methyl donor. Arginine methylation is implicated in signal transduction, RNA transport, and RNA splicing.Arginine methylation is an apparently irreversible protein modification catalyzed by arginine methyltransferases, such as PMT7, using S-adenosylmethionine (AdoMet) as the methyl donor. Arginine methylation is implicated in signal transduction, RNA transport, and RNA splicing (Miranda et al., 2004 [PubMed 15044439]). [supplied by OMIM] |
| Synonyms | FLJ10640; KIAA1933 |
| Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 92%; Guinea pig: 92%; Zebrafish: 86% |
| Reference Data | |
| Protein Families | Druggable Genome |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
Antibodies are the superheroes of our immune system and I recently got my hands on the latest and greatest one! It's like a cape for your cells, saving them from evil germs and viruses.
This particular antibody is like a one-man army, ready to take on anything that comes its way. I mean, it's got some serious biceps, folks! I've never seen an antibody that's so buff, I wouldn't be surprised if it could bench-press a flu virus.
What's more, it's incredibly stealthy. I've never seen an antibody move so smoothly, it's like watching a ninja in action. The germs don't even see it coming, it's like a covert operation every time.
All in all, I'm thoroughly impressed with this antibody. I feel like I've got a secret weapon in my bloodstream now. I'll be ready for anything that comes my way! Germs, beware!
null null on 05/22/2023
Nice
null null on 01/26/2023
