RBMS3 Rabbit Polyclonal Antibody

CAT#: TA345702

Rabbit Polyclonal Anti-RBMS3 Antibody

Product Images

WB Suggested Anti-RBMS3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: OVCAR-3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: IHC, WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RBMS3 antibody: synthetic peptide directed towards the middle region of human RBMS3. Synthetic peptide located within the following region: PTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: RNA binding motif single stranded interacting protein 3
• Database Link:
  NP_001003792
  Entrez Gene 27303 Human
  UniProt ID Q6XE24
• Background: RBMS3 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally desc
• Synonyms: FLJ36544
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Mouse: 92%; Bovine: 92%