CCBL2 (KYAT3) Rabbit Polyclonal Antibody

CAT#: TA345719

Rabbit Polyclonal Anti-CCBL2 Antibody

Product Images

WB Suggested Anti-CCBL2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CCBL2 antibody: synthetic peptide directed towards the C terminal of human CCBL2. Synthetic peptide located within the following region: LSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: kynurenine aminotransferase 3
• Database Link:
  NP_001008662
  Entrez Gene 56267 Human
  UniProt ID Q6YP21
• Background: CCBL2 is an aminotransferase that transaminates kynurenine to form kynurenic acid. Kynurenic acid is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. One of the transcripts encodes a predicted protein that has sequence identity to the protein encoded by the RNA binding motif protein, X-linked gene (RBMX).This gene encodes an aminotransferase that transaminates kynurenine to form kynurenic acid. Kynurenic acid is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. One of the transcripts encodes a predicted protein that has sequence identity to the protein encoded by the RNA binding motif protein, X-linked gene (RBMX).
• Synonyms: CCBL2; KAT3; KATIII
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%