CCBL2 (KYAT3) Rabbit Polyclonal Antibody

CAT#: TA345720

Rabbit Polyclonal Anti-RP11-82K18.3 Antibody

Product Images

WB Suggested Anti-RP11-82K18.3 Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat cell lysate; CCBL2 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RP11-82K18.3 antibody: synthetic peptide directed towards the N terminal of human RP11-82K18.3. Synthetic peptide located within the following region: SGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: kynurenine aminotransferase 3
• Database Link:
  NP_001008662
  Entrez Gene 56267 Human
  UniProt ID Q6YP21
• Background: RP11-82K18.3 is an aminotransferase that transaminates kynurenine to form kynurenic acid. Kynurenic acid is a metabolite of tryptophan.
• Synonyms: CCBL2; KAT3; KATIII
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 92%; Rat: 91%; Zebrafish: 91%; Rabbit: 86%; Guinea pig: 85%