Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) Rabbit Polyclonal Antibody

CAT#: TA345730

Rabbit Polyclonal Anti-RP11-78J21.1 Antibody

Product Images

WB Suggested Anti-RP11-78J21.1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate.HNRNPA1L2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Rabbit Anti-RP11-78J21.1 Antibody; Paraffin Embedded Tissue: Human Skin; Cellular Data: Epidermal cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RP11-78J21.1 antibody: synthetic peptide directed towards the N terminal of human RP11-78J21.1. Synthetic peptide located within the following region: MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: heterogeneous nuclear ribonucleoprotein A1-like 2
• Database Link:
  NP_001011724
  Entrez Gene 144983 Human
  UniProt ID Q32P51
• Background: The function remains unknown.
• Synonyms: MGC102957
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 93%; Guinea pig: 93%

Reference Data

• Protein Pathways: Spliceosome