SERBP1 Rabbit Polyclonal Antibody

CAT#: TA345745

Rabbit Polyclonal Anti-SERBP1 Antibody

Product Images

WB Suggested Anti-SERBP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: MCF7 cell lysate.There is BioGPS gene expression data showing that SERBP1 is expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SERBP1 antibody: synthetic peptide directed towards the C terminal of human SERBP1. Synthetic peptide located within the following region: PNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPANDITSQLEINFG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: SERPINE1 mRNA binding protein 1
• Database Link:
  NP_001018077
  Entrez Gene 26135 Human
  UniProt ID Q8NC51
• Background: SERBP1 may play a role in the regulation of mRNA stability. It binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay.
• Synonyms: CGI-55; CHD3IP; HABP4L; PAI-RBP1; PAIRBP1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 86%