KIAA0020 (PUM3) Rabbit Polyclonal Antibody

CAT#: TA345758

Rabbit Polyclonal Anti-KIAA0020 Antibody

Product Images

WB Suggested Anti-KIAA0020 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate.KIAA0020 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Paraffin Embedded Tissue: Human Lung Cellular Data: Alveolar cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X

• 

  Rabbit Anti-KIAA0020 Antibody; Paraffin Embedded Tissue: Human alveolar cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIAA0020 antibody: synthetic peptide directed towards the N terminal of human KIAA0020. Synthetic peptide located within the following region: GKKGVKQFKNKQQGDKSPKNKFQPANKFNKKRKFQPDGRSDESAAKKPKW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 71 kDa
• Gene Name: pumilio RNA binding family member 3
• Database Link:
  NP_001026861
  Entrez Gene 9933 Human
  UniProt ID Q15397
• Background: KIAA0020 contains 6 pumilio repeats and 1PUM-HD domain. The function remains unknown.
• Synonyms: HBV X-transactivated gene 5 protein; HLA-HA8; KIAA0020 protein; MGC8749; minor histocompatibility antigen HA-8; PEN; penguin homolog; protein 5 transactivated by hepatitis B virus X antigen (HBxAg); PUF6; RP11-526D20.2; XTP5
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 86%; Bovine: 86%; Rabbit: 79%; Guinea pig: 79%