DAP5 (EIF4G2) Rabbit Polyclonal Antibody

CAT#: TA345777

Rabbit Polyclonal Anti-EIF4G2 Antibody

Product Images

WB Suggested Anti-EIF4G2 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

• 

  Sample Type: 1. IAH30 cells (0.5x106 cells loaded); 2. DF-1 cells (0.5x106 cells loaded); Primary Dilution: 1: 1000; Secondary Antibody: Goat anti-rabbit IgG (whole molecule) peroxidase; Secondary Dilution: 1: 10, 000;

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Chicken, Human, Turkey
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EIF4G2 antibody: synthetic peptide directed towards the C terminal of human EIF4G2. Synthetic peptide located within the following region: KGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: eukaryotic translation initiation factor 4 gamma 2
• Database Link:
  NP_001036024
  Entrez Gene 1982 Human
  UniProt ID P78344
• Background: Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. EIF4G2 shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, EIF4G2 functions as a general repressor of translation by forming translationally inactive complexes.
• Synonyms: AAG1; DAP5; NAT1; P97
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Viral myocarditis