Fibrillarin (FBL) Rabbit Polyclonal Antibody

CAT#: TA345779

Rabbit Polyclonal Anti-FBL Antibody

Product Images

WB Suggested Anti-FBL Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 12500; Positive Control: Jurkat cell lysate; FBL is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Rabbit Anti-FBL Antibody; Paraffin Embedded Tissue: Human Intestine; Cellular Data: Epithelial cells of intestinal villas; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FBL antibody: synthetic peptide directed towards the N terminal of human FBL. Synthetic peptide located within the following region: GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: fibrillarin
• Database Link:
  NP_001427
  Entrez Gene 2091 Human
  UniProt ID P22087
• Background: FBL is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. FBL contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.This gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. The encoded protein contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.
• Synonyms: FIB; FLRN; RNU3IP1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rabbit: 93%; Bovine: 86%

Reference Data

• Protein Families: Stem cell - Pluripotency