Aconitase 1 (ACO1) Rabbit Polyclonal Antibody
Frequently bought together (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 159.00
Other products for "ACO1"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human, Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ACO1 antibody: synthetic peptide directed towards the N terminal of human ACO1. Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 98 kDa |
Gene Name | aconitase 1 |
Database Link | |
Background | ACO1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). It plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.Aconitase 1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. The iron-induced binding to the IRE results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degrading transferrin receptor mRNA. Thus, IREB1 plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes. |
Synonyms | ACONS; HEL60; IREB1; IREBP; IREBP1; IRP1 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Mouse: 93%; Horse: 92%; Guinea pig: 91%; Rabbit: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Citrate cycle (TCA cycle), Glyoxylate and dicarboxylate metabolism, Metabolic pathways |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.