SNRPB Rabbit Polyclonal Antibody

CAT#: TA345827

Rabbit Polyclonal Anti-SNRPB Antibody

Product Images

WB Suggested Anti-SNRPB Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SNRPB antibody: synthetic peptide directed towards the N terminal of human SNRPB. Synthetic peptide located within the following region: DKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: small nuclear ribonucleoprotein polypeptides B and B1
• Database Link:
  NP_003082
  Entrez Gene 6628 Human
  UniProt ID P14678
• Background: SNRPB is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing or
• Synonyms: B; CCMS; COD; Sm-B; SmB; snRNP-B; SNRPB1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Spliceosome, Systemic lupus erythematosus