SNRPN Rabbit Polyclonal Antibody

CAT#: TA345830

Rabbit Polyclonal Anti-SNRPN Antibody

Product Images

WB Suggested Anti-SNRPN Antibody; Titration: 1.0 ug/ml; Positive Control: THP-1 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SNRPN antibody: synthetic peptide directed towards the N terminal of human SNRPN. Synthetic peptide located within the following region: DEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: small nuclear ribonucleoprotein polypeptide N
• Database Link:
  NP_003088
  Entrez Gene 6638 Human
  UniProt ID P63162
• Background: The protein encoded by this gene is one polypeptide of a small nuclear ribonucleoprotein complex and belongs to the snRNP SMB/SMN family. The protein plays a role in pre-mRNA processing, possibly tissue-specific alternative splicing events. Although individual snRNPs are believed to recognize specific nucleic acid sequences through RNA-RNA base pairing, the specific role of this family member is unknown. The protein arises from a bicistronic transcript that also encodes a protein identified as the SNRPN upstream reading frame (SNURF).
• Synonyms: HCERN3; PWCR; PWS; RT-LI; SM-D; sm-N; SMN; SNRNP-N; SNURF-SNRPN
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Stem cell - Pluripotency