SRPR alpha (SRPRA) Rabbit Polyclonal Antibody

CAT#: TA345836

Rabbit Polyclonal Anti-SRPR Antibody

Product Images

WB Suggested Anti-SRPR Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SRPR antibody: synthetic peptide directed towards the middle region of human SRPR. Synthetic peptide located within the following region: EEFIQKHGRGMEKSNKSTKSDAPKEKGKKAPRVWELGGCANKEVLDYSTP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 70 kDa
• Gene Name: SRP receptor alpha subunit
• Database Link:
  NP_003130
  Entrez Gene 6734 Human
  UniProt ID P08240
• Background: SRPR belongs to the GTP-binding SRP family. It is in conjunction with SRP, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system.
• Synonyms: DP; Sralpha; SRPR
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 86%; Rat: 79%; Mouse: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Protein export