hnRNP U (HNRNPU) Rabbit Polyclonal Antibody

CAT#: TA345875

Rabbit Polyclonal Anti-HNRNPU Antibody

Product Images

WB Suggested Anti-HNRNPU Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: ACHN cell lysate; HNRNPU is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HNRNPU antibody: synthetic peptide directed towards the C terminal of human HNRNPU. Synthetic peptide located within the following region: EITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 90 kDa
• Gene Name: heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A)
• Database Link:
  NP_114032
  Entrez Gene 3192 Human
  UniProt ID Q00839
• Background: HNRNPU belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. HNRNPU contains a RNA binding domain and scaffold-associated region (SAR)-specific bipartite DNA-binding domain. This protein is also thought to be involved in the packaging of hnRNA into large ribonucleoprotein complexes. During apoptosis, this protein is cleaved in a caspase-dependent way. But this cleavage does not affect the function of the encoded protein in RNA metabolism.
• Synonyms: hnRNP U; HNRNPU-AS1; HNRPU; SAF-A; SAFA; U21.1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Spliceosome