RO60 Rabbit Polyclonal Antibody

CAT#: TA345888

Rabbit Polyclonal Anti-TROVE2 Antibody

Product Images

WB Suggested Anti-TROVE2 Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate

• 

  Rabbit Anti-TROVE2 Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TROVE2 antibody: synthetic peptide directed towards the N terminal of human TROVE2. Synthetic peptide located within the following region: QKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: TROVE domain family member 2
• Database Link:
  NP_001035828
  Entrez Gene 6738 Human
  UniProt ID P10155
• Background: As a RNA-binding protein, TROVE2 binds to several small cytoplasmic RNA molecules known as Y RNAs. It may stabilize these RNAs from degradation.
• Synonyms: RO60; RORNP; SSA2
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Systemic lupus erythematosus