RO60 Rabbit Polyclonal Antibody
Frequently bought together (1)
Other products for "RO60"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TROVE2 antibody: synthetic peptide directed towards the N terminal of human TROVE2. Synthetic peptide located within the following region: QDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 58 kDa |
Gene Name | TROVE domain family member 2 |
Database Link | |
Background | TROVE2 belongs to the Ro 60 kDa family. It is RNA-binding protein that binds to several small cytoplasmic RNA molecules known as Y RNAs. It may stabilize these RNAs from degradation. |
Synonyms | RO60; RORNP; SSA2 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93% |
Reference Data | |
Protein Families | Transcription Factors |
Protein Pathways | Systemic lupus erythematosus |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.