SFRS11 (SRSF11) Rabbit Polyclonal Antibody

CAT#: TA345898

Rabbit Polyclonal Anti-SFRS11 Antibody

Product Images

WB Suggested Anti-SFRS11 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Hela cell lysate; There is BioGPS gene expression data showing that SRSF11 is expressed in Hela

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SFRS11 antibody: synthetic peptide directed towards the C terminal of human SFRS11. Synthetic peptide located within the following region: KKKSKDKEKDRERKSESDKDVKQVTRDYDEEEQGYDSEKEKKEEKKPIET
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: serine/arginine-rich splicing factor 11
• Database Link:
  NP_004759
  Entrez Gene 9295 Human
  UniProt ID Q05519
• Background: SFRS11 is 54-kD nuclear protein that contains an arginine/serine-rich region similar to segments found in pre-mRNA splicing factors. Although the function of this protein is not yet known, structure and immunolocalization data suggest that it may play a role in pre-mRNA processing.This gene encodes 54-kD nuclear protein that contains an arginine/serine-rich region similar to segments found in pre-mRNA splicing factors. Although the function of this protein is not yet known, structure and immunolocalization data suggest that it may play a role in pre-mRNA processing.
• Synonyms: dJ677H15.2; NET2; p54; SFRS11
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Pig: 93%; Mouse: 93%; Bovine: 93%