SFPQ Rabbit Polyclonal Antibody

CAT#: TA345906

Rabbit Polyclonal Anti-SFPQ Antibody

Product Images

WB Suggested Anti-SFPQ Antibody Titration: 5.0 ug/ml; Positive Control: Jurkat cell lysate; SFPQ is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Rabbit Anti-SFPQ Antibody; Paraffin Embedded Tissue: Human Muscle; Cellular Data: Skeletal muscle cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SFPQ antibody: synthetic peptide directed towards the middle region of human SFPQ. Synthetic peptide located within the following region: PVIVEPLEQLDDEDGLPEKLAQKNPMYQKERETPPRFAQHGTFEYEYSQR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 78 kDa
• Gene Name: splicing factor proline/glutamine-rich
• Database Link:
  NP_005057
  Entrez Gene 6421 Human
  UniProt ID P23246
• Background: SFPQ is DNA- and RNA binding protein. It is essential pre-mRNA splicing factor required early in spliceosome formation and for splicing catalytic step II, probably as an heteromer with NONO. It binds to pre-mRNA in spliceosome C complex, and specifically binds to intronic polypyrimidine tracts. It interacts with U5 snRNA. It may be involved in a pre-mRNA coupled splicing and polyadenylation process as component of a snRNP-free complex with SNRPA/U1A. SFPQ may be involved in homologous DNA pairing. SFPQ is involved in transcriptional regulation. It binds the DNA sequence 5'-CTGAGTC-3' in the insulin-like growth factor response element (IGFRE) and inhibits IGF-I-stimulated transcriptional activity.
• Synonyms: POMP100; PPP1R140; PSF
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%

Reference Data

• Protein Families: Transcription Factors