SFPQ Rabbit Polyclonal Antibody

CAT#: TA345907

Rabbit Polyclonal Anti-SFPQ Antibody


USD 410.00

5 Days*

Size
    • 100 ul

Frequently bought together (2)
Transient overexpression lysate of splicing factor proline/glutamine-rich (polypyrimidine tract binding protein associated) (SFPQ)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "SFPQ"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SFPQ antibody: synthetic peptide directed towards the N terminal of human SFPQ. Synthetic peptide located within the following region: VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 78 kDa
Gene Name splicing factor proline/glutamine-rich
Background SFPQ is DNA- and RNA binding protein. It is essential pre-mRNA splicing factor required early in spliceosome formation and for splicing catalytic step II, probably as an heteromer with NONO. It binds to pre-mRNA in spliceosome C complex, and specifically binds to intronic polypyrimidine tracts. It interacts with U5 snRNA. It may be involved in a pre-mRNA coupled splicing and polyadenylation process as component of a snRNP-free complex with SNRPA/U1A. SFPQ may be involved in homologous DNA pairing. SFPQ is involved in transcriptional regulation. It binds the DNA sequence 5'-CTGAGTC-3' in the insulin-like growth factor response element (IGFRE) and inhibits IGF-I-stimulated transcriptional activity.
Synonyms POMP100; PPP1R140; PSF
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.